LOC161247 Blocking Peptide (33R-10094)
A synthetic peptide for use as a blocking control in assays to test for specificity of LOC161247 antibody, catalog no. 70R-7083
Overview
Overview
| Synonyms | LOC161247 control peptide, LOC161247 antibody Blocking Peptide, Anti-LOC161247 Blocking Peptide, MGC46490 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | YFHQYTHKVVGAAVGTFAWYLTYGSWYHQPWSPGSPGHGLFPRPHSSRKH |
|---|---|
| Molecular Weight | 32 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | FIT1 (LOC161247) belongs to an evolutionarily conserved family of proteins involved in fat storage. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product