LOC203547 antibody (70R-1806)

Rabbit polyclonal LOC203547 antibody raised against the N terminal of LOC203547

Synonyms Polyclonal LOC203547 antibody, Anti-LOC203547 antibody, MGC131652 antibody, LOC-203547, MGC125516 antibody, LOC 203547 antibody, MGC125514 antibody, LOC 203547, Hypothetical Protein Loc203547 antibody, LOC-203547 antibody, LOC203547
Specificity LOC203547 antibody was raised against the N terminal of LOC203547
Cross Reactivity Human
Applications IHC, WB
Immunogen LOC203547 antibody was raised using the N terminal of LOC203547 corresponding to a region with amino acids MERPDKAALNALQPPEFRNESSLASTLKTLLFFTALMITVPIGLYFTTKS
Assay Information LOC203547 Blocking Peptide, catalog no. 33R-5954, is also available for use as a blocking control in assays to test for specificity of this LOC203547 antibody


Western Blot analysis using LOC203547 antibody (70R-1806)

LOC203547 antibody (70R-1806) used at 5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 11 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of LOC203547 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of LOC203547 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using LOC203547 antibody (70R-1806) | LOC203547 antibody (70R-1806) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors