LOC283130 antibody (70R-1791)

Rabbit polyclonal LOC283130 antibody raised against the C terminal Of Loc283130

Synonyms Polyclonal LOC283130 antibody, Anti-LOC283130 antibody, LOC-283130, LOC-283130 antibody, LOC 283130, LOC 283130 antibody, LOC283130
Specificity LOC283130 antibody was raised against the C terminal Of Loc283130
Cross Reactivity Human
Applications IHC, WB
Immunogen LOC283130 antibody was raised using the C terminal Of Loc283130 corresponding to a region with amino acids GLRRRVYQGMLDCMVSSIRQEGLGVFFRGVTINSARAFPVNAVTFLSYEY
Assay Information LOC283130 Blocking Peptide, catalog no. 33R-3419, is also available for use as a blocking control in assays to test for specificity of this LOC283130 antibody


Immunohistochemical staining using LOC283130 antibody (70R-1791)

LOC283130 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 27 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of LOC283130 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC25A45 belongs to the SLC25 family of mitochondrial carrier proteins.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using LOC283130 antibody (70R-1791) | LOC283130 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using LOC283130 antibody (70R-1791) | LOC283130 antibody (70R-1791) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors