LOC284009 antibody (70R-3217)

Rabbit polyclonal LOC284009 antibody raised against the N terminal of LOC284009

Synonyms Polyclonal LOC284009 antibody, Anti-LOC284009 antibody, Hypothetical Protein Loc284009 antibody, MGC138239 antibody, LOC 284009 antibody, LOC-284009 antibody, LOC 284009, LOC-284009, LOC284009
Specificity LOC284009 antibody was raised against the N terminal of LOC284009
Cross Reactivity Human
Applications WB
Immunogen LOC284009 antibody was raised using the N terminal of LOC284009 corresponding to a region with amino acids IRCGRPAVVHIGGEGARWEKGARGRKEHRLRRSDLGSRPVPFLAQGIPDI
Assay Information LOC284009 Blocking Peptide, catalog no. 33R-4129, is also available for use as a blocking control in assays to test for specificity of this LOC284009 antibody

Images

Western Blot analysis using LOC284009 antibody (70R-3217)

LOC284009 antibody (70R-3217) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 17 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LOC284009 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of LOC284009 protein has not been widely studied, and is yet to be fully elucidated.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LOC284009 antibody (70R-3217) | LOC284009 antibody (70R-3217) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors