LOC339123 antibody (70R-3106)

Rabbit polyclonal LOC339123 antibody raised against the middle region of LOC339123

Synonyms Polyclonal LOC339123 antibody, Anti-LOC339123 antibody, Hypothetical Loc339123 antibody, LOC-339123, LOC-339123 antibody, LOC 339123 antibody, LOC 339123, LOC339123, PP14397 antibody
Specificity LOC339123 antibody was raised against the middle region of LOC339123
Cross Reactivity Human
Applications WB
Immunogen LOC339123 antibody was raised using the middle region of LOC339123 corresponding to a region with amino acids SFGDRVVRLSTANTYSYHKVDLPFQEYVEQLLHPQDPTSLGNDTLYFFGD
Assay Information LOC339123 Blocking Peptide, catalog no. 33R-8426, is also available for use as a blocking control in assays to test for specificity of this LOC339123 antibody

Images

Western blot analysis using LOC339123 antibody (70R-3106)

Recommended JMJD8 Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LOC339123 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of LOC339123 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using LOC339123 antibody (70R-3106) | Recommended JMJD8 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors