LOC339123 Blocking Peptide (33R-8426)
A synthetic peptide for use as a blocking control in assays to test for specificity of LOC339123 antibody, catalog no. 70R-3106
Overview
Overview
| Synonyms | LOC339123 control peptide, LOC339123 antibody Blocking Peptide, Anti-LOC339123 Blocking Peptide, Hypothetical Loc339123 Blocking Peptide, PP14397 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | SFGDRVVRLSTANTYSYHKVDLPFQEYVEQLLHPQDPTSLGNDTLYFFGD |
|---|---|
| Molecular Weight | 32 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The function of LOC339123 protein is not widely studied, and is yet to be elucidated fully. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product