LOC402573 Blocking Peptide (33R-10183)
A synthetic peptide for use as a blocking control in assays to test for specificity of LOC402573 antibody, catalog no. 70R-4441
Overview
Overview
| Synonyms | LOC402573 control peptide, LOC402573 antibody Blocking Peptide, Anti-LOC402573 Blocking Peptide, Hypothetical Loc402573 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | YLVLWAVRKHLRRLYRRQERHRRHHVRCHAAPRPNPAQSLKLDAQSPL |
|---|---|
| Molecular Weight | 24 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The function of LOC402573 protein has not been widely studied, and is yet to be fully elucidated. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product