LOC51057 antibody (70R-5442)

Rabbit polyclonal LOC51057 antibody raised against the N terminal of LOC51057

Synonyms Polyclonal LOC51057 antibody, Anti-LOC51057 antibody, LOC51057, LOC 51057, LOC-51057 antibody, LOC 51057 antibody, DKFZp686C12204 antibody, LOC-51057, Hypothetical Protein Loc51057 antibody
Specificity LOC51057 antibody was raised against the N terminal of LOC51057
Cross Reactivity Human
Applications WB
Immunogen LOC51057 antibody was raised using the N terminal of LOC51057 corresponding to a region with amino acids LAQNKLCFIQFTKKMESSDVNKRLEKLSALDYKIFYYEIPGPINKTTERH
Assay Information LOC51057 Blocking Peptide, catalog no. 33R-4791, is also available for use as a blocking control in assays to test for specificity of this LOC51057 antibody


Western Blot analysis using LOC51057 antibody (70R-5442)

LOC51057 antibody (70R-5442) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 68 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LOC51057 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of LOC51057 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using LOC51057 antibody (70R-5442) | LOC51057 antibody (70R-5442) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors