LOC647169 antibody (70R-2200)

Rabbit polyclonal LOC647169 antibody raised against the C terminal of LOC647169

Synonyms Polyclonal LOC647169 antibody, Anti-LOC647169 antibody, LOC 647169, LOC 647169 antibody, LOC-647169, LOC647169, LOC-647169 antibody, Similar To Glutathione Transferase antibody
Specificity LOC647169 antibody was raised against the C terminal of LOC647169
Cross Reactivity Human
Applications WB
Immunogen LOC647169 antibody was raised using the C terminal of LOC647169 corresponding to a region with amino acids KAVLCALRALKIRISKLPTVKKFLQPGSLRKLPIDAKGLQEATKIFKV
Assay Information LOC647169 Blocking Peptide, catalog no. 33R-4263, is also available for use as a blocking control in assays to test for specificity of this LOC647169 antibody

Images

Western Blot analysis using LOC647169 antibody (70R-2200)

LOC647169 antibody (70R-2200) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LOC647169 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of LOC647169 protein has not been widely studied, and is yet to be fully elucidated.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LOC647169 antibody (70R-2200) | LOC647169 antibody (70R-2200) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors