LOC650515 antibody (70R-2170)

Rabbit polyclonal LOC650515 antibody raised against the C terminal of LOC650515

Synonyms Polyclonal LOC650515 antibody, Anti-LOC650515 antibody, LOC-650515, Similar To Beta-14-Mannosyltransferase antibody, LOC650515, LOC 650515, LOC-650515 antibody, LOC 650515 antibody
Specificity LOC650515 antibody was raised against the C terminal of LOC650515
Cross Reactivity Human
Applications WB
Immunogen LOC650515 antibody was raised using the C terminal of LOC650515 corresponding to a region with amino acids VQTVLPLVMDTELLGQRLKPQGPCCPSRSFFSESQGKSFRVAPPSGQKLI
Assay Information LOC650515 Blocking Peptide, catalog no. 33R-9764, is also available for use as a blocking control in assays to test for specificity of this LOC650515 antibody


Western Blot analysis using LOC650515 antibody (70R-2170)

LOC650515 antibody (70R-2170) used at 0.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LOC650515 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The sequence of LOC650515 is derived from an annotated genomic sequence (NW_922073) using gene prediction method: GNOMON, supported by EST evidence. The exact function of LOC650515 remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using LOC650515 antibody (70R-2170) | LOC650515 antibody (70R-2170) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors