LOC650515 Blocking Peptide (33R-9764)

A synthetic peptide for use as a blocking control in assays to test for specificity of LOC650515 antibody, catalog no. 70R-2170

Synonyms LOC650515 control peptide, LOC650515 antibody Blocking Peptide, Anti-LOC650515 Blocking Peptide, Similar To Beta-14-Mannosyltransferase Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues VQTVLPLVMDTELLGQRLKPQGPCCPSRSFFSESQGKSFRVAPPSGQKLI
Molecular Weight 39 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The sequence of LOC650515 is derived from an annotated genomic sequence (NW_922073) using gene prediction method: GNOMON, supported by EST evidence. The exact function of LOC650515 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors