LOC650515 Blocking Peptide (33R-9764)
A synthetic peptide for use as a blocking control in assays to test for specificity of LOC650515 antibody, catalog no. 70R-2170
Overview
Overview
| Synonyms | LOC650515 control peptide, LOC650515 antibody Blocking Peptide, Anti-LOC650515 Blocking Peptide, Similar To Beta-14-Mannosyltransferase Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | VQTVLPLVMDTELLGQRLKPQGPCCPSRSFFSESQGKSFRVAPPSGQKLI |
|---|---|
| Molecular Weight | 39 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The sequence of LOC650515 is derived from an annotated genomic sequence (NW_922073) using gene prediction method: GNOMON, supported by EST evidence. The exact function of LOC650515 remains unknown. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product