LOH11CR2A Blocking Peptide (33R-9184)

A synthetic peptide for use as a blocking control in assays to test for specificity of LOH11CR2A antibody, catalog no. 70R-9303

Synonyms LOH11CR2A control peptide, LOH11CR2A antibody Blocking Peptide, Anti-LOH11CR2A Blocking Peptide, von Willebrand factor A domain containing 5A Blocking Peptide, BCSC-1 Blocking Peptide, BCSC1 Blocking Peptide, LOH11CR2A, LOHCR2A-11, LOHCR2A 11, LOHCR2A-11 Blocking Peptide, LOHCR2A 11 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues TLSMVATIDSQHGIEKVQSNCPLSPTEYLGEDKTSAQVSLAAGHKFDRDV
Molecular Weight 86 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LOH11CR2A may play a role in tumorigenesis as a tumor suppressor. Altered expression of this protein and disruption of the molecular pathway it is involved in, may contribute directly to or modify tumorigenesis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors