LOH11CR2A Blocking Peptide (33R-9184)
A synthetic peptide for use as a blocking control in assays to test for specificity of LOH11CR2A antibody, catalog no. 70R-9303
Overview
Overview
| Synonyms | LOH11CR2A control peptide, LOH11CR2A antibody Blocking Peptide, Anti-LOH11CR2A Blocking Peptide, von Willebrand factor A domain containing 5A Blocking Peptide, BCSC-1 Blocking Peptide, BCSC1 Blocking Peptide, LOH11CR2A, LOHCR2A-11, LOHCR2A 11, LOHCR2A-11 Blocking Peptide, LOHCR2A 11 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | TLSMVATIDSQHGIEKVQSNCPLSPTEYLGEDKTSAQVSLAAGHKFDRDV |
|---|---|
| Molecular Weight | 86 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | LOH11CR2A may play a role in tumorigenesis as a tumor suppressor. Altered expression of this protein and disruption of the molecular pathway it is involved in, may contribute directly to or modify tumorigenesis. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product