Lp (a) Blocking Peptide (33R-8931)
A synthetic peptide for use as a blocking control in assays to test for specificity of LPA antibody, catalog no. 70R-10023
Overview
Overview
| Synonyms | Lp (a) control peptide, Lp (a) antibody Blocking Peptide, Anti-Lp (a) Blocking Peptide, lipoprotein, LPA Blocking Peptide, LP Blocking Peptide, AK38 Blocking Peptide, APOA Blocking Peptide, LPA Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | SVRWEYCNLTRCPVTESSVLTTPTVAPVPSTEAPSEQAPPEKSPVVQDCY |
|---|---|
| Molecular Weight | 120 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | LPA is a serine proteinase that inhibits the activity of tissue-type plasminogen activator I. The protein constitutes a substantial portion of lipoprotein(a) and is proteolytically cleaved, resulting in fragments that attach to atherosclerotic lesions and promote thrombogenesis. Elevated plasma levels of this protein are linked to atherosclerosis. Depending on the individual, the protein contains 2-43 copies of kringle-type domains. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product