Lp (a) Blocking Peptide (33R-9718)

A synthetic peptide for use as a blocking control in assays to test for specificity of LPA antibody, catalog no. 70R-10024

Synonyms Lp (a) control peptide, Lp (a) antibody Blocking Peptide, Anti-Lp (a) Blocking Peptide, lipoprotein, LPA Blocking Peptide, LP Blocking Peptide, AK38 Blocking Peptide, APOA Blocking Peptide, LPA Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues VPDPSTEASSEEAPTEQSPGVQDCYHGDGQSYRGSFSTTVTGRTCQSWSS
Molecular Weight 120 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LPA is a serine proteinase that inhibits the activity of tissue-type plasminogen activator I. The protein constitutes a substantial portion of lipoprotein(a) and is proteolytically cleaved, resulting in fragments that attach to atherosclerotic lesions and promote thrombogenesis. Elevated plasma levels of this protein are linked to atherosclerosis. Depending on the individual, the protein contains 2-43 copies of kringle-type domains.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors