LRDD antibody (70R-5426)

Rabbit polyclonal LRDD antibody raised against the N terminal of LRDD

Synonyms Polyclonal LRDD antibody, Anti-LRDD antibody, PIDD antibody, DKFZp434D229 antibody, Leucine-Rich Repeats And Death Domain Containing antibody, MGC16925 antibody
Specificity LRDD antibody was raised against the N terminal of LRDD
Cross Reactivity Human
Applications WB
Immunogen LRDD antibody was raised using the N terminal of LRDD corresponding to a region with amino acids RLQGNPLGEASPDAPSSPVAALIPEMPRLFLTSDLDSFPVTPQGCSVTLA
Assay Information LRDD Blocking Peptide, catalog no. 33R-8046, is also available for use as a blocking control in assays to test for specificity of this LRDD antibody

Images

Western Blot analysis using LRDD antibody (70R-5426)

LRDD antibody (70R-5426) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 83 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LRDD antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene contains a leucine-rich repeat and a death domain. This protein has been shown to interact with other death domain proteins, such as Fas (TNFRSF6)-associated via death domain (FADD) and MAP-kinase activating death domain-containing protein (MADD), and thus may function as an adaptor protein in cell death-related signaling processes. The expression of the mouse counterpart of this gene has been found to be positively regulated by the tumor suppressor p53 and to induce cell apoptosis in response to DNA damage, which suggests a role for this gene as an effector of p53-dependent apoptosis. Three alternatively spliced transcript variants encoding distinct isoforms have been reported.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LRDD antibody (70R-5426) | LRDD antibody (70R-5426) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors