LRDD Blocking Peptide (33R-8046)

A synthetic peptide for use as a blocking control in assays to test for specificity of LRDD antibody, catalog no. 70R-5426

Synonyms LRDD control peptide, LRDD antibody Blocking Peptide, Anti-LRDD Blocking Peptide, Leucine-Rich Repeats And Death Domain Containing Blocking Peptide, DKFZp434D229 Blocking Peptide, MGC16925 Blocking Peptide, PIDD Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues RLQGNPLGEASPDAPSSPVAALIPEMPRLFLTSDLDSFPVTPQGCSVTLA
Molecular Weight 83 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene contains a leucine-rich repeat and a death domain. This protein has been shown to interact with other death domain proteins, such as Fas (TNFRSF6)-associated via death domain (FADD) and MAP-kinase activating death domain-containing protein (MADD), and thus may function as an adaptor protein in cell death-related signaling processes. The expression of the mouse counterpart of this gene has been found to be positively regulated by the tumor suppressor p53 and to induce cell apoptosis in response to DNA damage, which suggests a role for this gene as an effector of p53-dependent apoptosis. Three alternatively spliced transcript variants encoding distinct isoforms have been reported.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors