LRP1 antibody (70R-2307)

Rabbit polyclonal LRP1 antibody

Synonyms Polyclonal LRP1 antibody, Anti-LRP1 antibody, LRP-1 antibody, LRP 1 antibody, Low Density Lipoprotein-Related Protein 1 antibody, LRP1, LRP-1, LRP 1, Alpha 2 Macroglobulin Receptor antibody
Cross Reactivity Human
Applications WB
Immunogen LRP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCAR
Assay Information LRP1 Blocking Peptide, catalog no. 33R-1578, is also available for use as a blocking control in assays to test for specificity of this LRP1 antibody

Images

Western Blot analysis using LRP1 antibody (70R-2307)

LRP1 antibody (70R-2307) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 48 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LRP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Low-density lipoprotein receptor-related protein 1 (.-2-macroglobulin receptor, LRP1) is a multifunctional endocytic receptor with an important role in regulating the activity of proteinases in the extracellular matrix. It is also involved in intracellular signaling and the subcellular translocation of preassembled signaling complexes from the plasma membrane.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LRP1 antibody (70R-2307) | LRP1 antibody (70R-2307) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors