LRPAP1 antibody (70R-1861)

Rabbit polyclonal LRPAP1 antibody raised against the C terminal of LRPAP1

Synonyms Polyclonal LRPAP1 antibody, Anti-LRPAP1 antibody, LRPAP1, LRPAP 1, LRPAP 1 antibody, LRPAP-1 antibody, Low Density Lipoprotein Receptor-Related Protein Associated Protein 1 antibody, RAP antibody, A2MRAP antibody, A2RAP antibody, LRPAP-1, MGC138272 antibody, MRAP antibody, HBP44 antibody
Specificity LRPAP1 antibody was raised against the C terminal of LRPAP1
Cross Reactivity Human,Mouse,Rat,Dog
Applications IHC, WB
Immunogen LRPAP1 antibody was raised using the C terminal of LRPAP1 corresponding to a region with amino acids IDLWDLAQSANLTDKELEAFREELKHFEAKIEKHNHYQKQLEIAHEKLRH
Assay Information LRPAP1 Blocking Peptide, catalog no. 33R-3922, is also available for use as a blocking control in assays to test for specificity of this LRPAP1 antibody


Immunohistochemical staining using LRPAP1 antibody (70R-1861)

LRPAP1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of LRPAP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LRPAP1 interacts with LRP1/alpha-2-macroglobulin receptor and glycoprotein 330.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using LRPAP1 antibody (70R-1861) | LRPAP1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using LRPAP1 antibody (70R-1861) | LRPAP1 antibody (70R-1861) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors