LRRC2 antibody (70R-1280)

Rabbit polyclonal LRRC2 antibody raised against the C terminal of LRRC2

Synonyms Polyclonal LRRC2 antibody, Anti-LRRC2 antibody, LRRC 2 antibody, LRRC-2 antibody, LRRC-2, LRRC2, LRRC 2, Leucine Rich Repeat Containing 2 antibody
Specificity LRRC2 antibody was raised against the C terminal of LRRC2
Cross Reactivity Human
Applications WB
Immunogen LRRC2 antibody was raised using the C terminal of LRRC2 corresponding to a region with amino acids NAQCEDGNEIMESERDRQHFDKEVMKAYIEDLKERESVPSYTTKVSFSLQ
Assay Information LRRC2 Blocking Peptide, catalog no. 33R-6643, is also available for use as a blocking control in assays to test for specificity of this LRRC2 antibody

Images

Western Blot analysis using LRRC2 antibody (70R-1280)

LRRC2 antibody (70R-1280) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of LRRC2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Leucine-rich repeats (LRRs) are 20-29 amino acid motifs that mediate proteinprotein interactions. The primary function of these motifs is to provide a versatile structural framework for the formation of these protein-protein interactions.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LRRC2 antibody (70R-1280) | LRRC2 antibody (70R-1280) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors