LRRC3 antibody (70R-4456)

Rabbit polyclonal LRRC3 antibody raised against the middle region of LRRC3

Synonyms Polyclonal LRRC3 antibody, Anti-LRRC3 antibody, Leucine Rich Repeat Containing 3 antibody, C21orf102 antibody, LRRC3, LRRC-3 antibody, LRRC 3 antibody, LRRC 3, LRRC-3
Specificity LRRC3 antibody was raised against the middle region of LRRC3
Cross Reactivity Human
Applications WB
Immunogen LRRC3 antibody was raised using the middle region of LRRC3 corresponding to a region with amino acids TFAGLAGGLRLLDLSYNRIQRIPKDALGKLSAKIRLSHNPLHCECALQEA
Assay Information LRRC3 Blocking Peptide, catalog no. 33R-9059, is also available for use as a blocking control in assays to test for specificity of this LRRC3 antibody

Images

Western Blot analysis using LRRC3 antibody (70R-4456)

LRRC3 antibody (70R-4456) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LRRC3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of LRRC3 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LRRC3 antibody (70R-4456) | LRRC3 antibody (70R-4456) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors