LRRN2 Blocking Peptide (33R-8253)
A synthetic peptide for use as a blocking control in assays to test for specificity of LRRN2 antibody, catalog no. 70R-6703
Overview
Overview
| Synonyms | LRRN2 control peptide, LRRN2 antibody Blocking Peptide, Anti-LRRN2 Blocking Peptide, Leucine Rich Repeat Neuronal 2 Blocking Peptide, FIGLER7 Blocking Peptide, GAC1 Blocking Peptide, LRANK1 Blocking Peptide, LRRN5 Blocking Peptide, LRRN2, LRRN-2, LRRN 2, LRRN-2 Blocking Peptide, LRRN 2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | RVPRRALEQVPGLKFLDLNKNPLQRVGPGDFANMLHLKELGLNNMEELVS |
|---|---|
| Molecular Weight | 79 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The protein encoded by this gene belongs to the leucine-rich repeat superfamily. This gene was found to be amplified and overexpressed in malignant gliomas. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product