LRRN2 Blocking Peptide (33R-8253)

A synthetic peptide for use as a blocking control in assays to test for specificity of LRRN2 antibody, catalog no. 70R-6703

Synonyms LRRN2 control peptide, LRRN2 antibody Blocking Peptide, Anti-LRRN2 Blocking Peptide, Leucine Rich Repeat Neuronal 2 Blocking Peptide, FIGLER7 Blocking Peptide, GAC1 Blocking Peptide, LRANK1 Blocking Peptide, LRRN5 Blocking Peptide, LRRN2, LRRN-2, LRRN 2, LRRN-2 Blocking Peptide, LRRN 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues RVPRRALEQVPGLKFLDLNKNPLQRVGPGDFANMLHLKELGLNNMEELVS
Molecular Weight 79 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene belongs to the leucine-rich repeat superfamily. This gene was found to be amplified and overexpressed in malignant gliomas.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors