LSM6 antibody (70R-4774)

Rabbit polyclonal LSM6 antibody

Synonyms Polyclonal LSM6 antibody, Anti-LSM6 antibody, LSM-6 antibody, YDR378C antibody, LSM-6, LSM6, LSM 6 antibody, LSM 6, Lsm6 Homolog U6 Small Nuclear Rna Associated antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen LSM6 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEE
Assay Information LSM6 Blocking Peptide, catalog no. 33R-6468, is also available for use as a blocking control in assays to test for specificity of this LSM6 antibody


Western Blot analysis using LSM6 antibody (70R-4774)

LSM6 antibody (70R-4774) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 9 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LSM6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family. Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using LSM6 antibody (70R-4774) | LSM6 antibody (70R-4774) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors