LTA4H antibody (70R-5880)

Rabbit polyclonal LTA4H antibody raised against the middle region of LTA4H

Synonyms Polyclonal LTA4H antibody, Anti-LTA4H antibody, LTAH 4 antibody, LTA4H, Leukotriene A4 Hydrolase antibody, LTAH 4, LTAH-4, LTAH-4 antibody
Specificity LTA4H antibody was raised against the middle region of LTA4H
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen LTA4H antibody was raised using the middle region of LTA4H corresponding to a region with amino acids NACIALSQRWITAKEDDLNSFNATDLKDLSSHQLNEFLAQTLQRAPLPLG
Assay Information LTA4H Blocking Peptide, catalog no. 33R-6634, is also available for use as a blocking control in assays to test for specificity of this LTA4H antibody


Western blot analysis using LTA4H antibody (70R-5880)

Recommended LTA4H Antibody Titration: 0.2-1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 69 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LTA4H antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LTA4H hydrolyzes an epoxide moiety of leukotriene A4 (LTA-4) to form leukotriene B4 (LTB-4). The enzyme also has some peptidase activity.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using LTA4H antibody (70R-5880) | Recommended LTA4H Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors