LTB4R Blocking Peptide (33R-1214)
A synthetic peptide for use as a blocking control in assays to test for specificity of LTB4R antibody, catalog no. 70R-7851
Overview
Overview
| Synonyms | LTB4R control peptide, LTB4R antibody Blocking Peptide, Anti-LTB4R Blocking Peptide, leukotriene B4 receptor Blocking Peptide, BLT1 Blocking Peptide, BLTR Blocking Peptide, CMKRL1 Blocking Peptide, GPR16 Blocking Peptide, LTB4R1 Blocking Peptide, LTBR1 Blocking Peptide, P2RY7 Blocking Peptide, P2Y7 Blocking Peptide, LTB4R, LTBR-4, LTBR 4, LTBR-4 Blocking Peptide, LTBR 4 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | AGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVG |
|---|---|
| Molecular Weight | 37 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | LTB4R is the receptor for extracellular ATP > UTP and ADP. The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system. LTB4R may be the cardiac P2Y receptor involved in the regulation of cardiac muscle contraction through modulation of L-type calcium currents. LTB4R is a receptor for leukotriene B4, a potent chemoattractant involved in inflammation and immune response. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product