LTB4R Blocking Peptide (33R-1214)

A synthetic peptide for use as a blocking control in assays to test for specificity of LTB4R antibody, catalog no. 70R-7851

Synonyms LTB4R control peptide, LTB4R antibody Blocking Peptide, Anti-LTB4R Blocking Peptide, leukotriene B4 receptor Blocking Peptide, BLT1 Blocking Peptide, BLTR Blocking Peptide, CMKRL1 Blocking Peptide, GPR16 Blocking Peptide, LTB4R1 Blocking Peptide, LTBR1 Blocking Peptide, P2RY7 Blocking Peptide, P2Y7 Blocking Peptide, LTB4R, LTBR-4, LTBR 4, LTBR-4 Blocking Peptide, LTBR 4 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues AGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVG
Molecular Weight 37 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LTB4R is the receptor for extracellular ATP > UTP and ADP. The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system. LTB4R may be the cardiac P2Y receptor involved in the regulation of cardiac muscle contraction through modulation of L-type calcium currents. LTB4R is a receptor for leukotriene B4, a potent chemoattractant involved in inflammation and immune response.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors