LTBP1 Blocking Peptide (33R-6910)
A synthetic peptide for use as a blocking control in assays to test for specificity of LTBP1 antibody, catalog no. 70R-10026
Overview
Overview
| Synonyms | LTBP1 control peptide, LTBP1 antibody Blocking Peptide, Anti-LTBP1 Blocking Peptide, latent transforming growth factor beta binding protein 1 Blocking Peptide, MGC163161 Blocking Peptide, LTBP1, LTBP-1, LTBP 1, LTBP-1 Blocking Peptide, LTBP 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | NVCANGDCSNLEGSYMCSCHKGYTRTPDHKHCRDIDECQQGNLCVNGQCK |
|---|---|
| Molecular Weight | 154 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The protein encoded by this gene belongs to the family of latent TGF-beta binding proteins (LTBPs). The secretion and activation of TGF-betas is regulated by their association with latency-associated proteins and with latent TGF-beta binding proteins. The product of this gene targets latent complexes of transforming growth factor beta to the extracellular matrix, where the latent cytokine is subsequently activated by several different mechanisms. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product