LTBP1 Blocking Peptide (33R-6910)

A synthetic peptide for use as a blocking control in assays to test for specificity of LTBP1 antibody, catalog no. 70R-10026

Synonyms LTBP1 control peptide, LTBP1 antibody Blocking Peptide, Anti-LTBP1 Blocking Peptide, latent transforming growth factor beta binding protein 1 Blocking Peptide, MGC163161 Blocking Peptide, LTBP1, LTBP-1, LTBP 1, LTBP-1 Blocking Peptide, LTBP 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues NVCANGDCSNLEGSYMCSCHKGYTRTPDHKHCRDIDECQQGNLCVNGQCK
Molecular Weight 154 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene belongs to the family of latent TGF-beta binding proteins (LTBPs). The secretion and activation of TGF-betas is regulated by their association with latency-associated proteins and with latent TGF-beta binding proteins. The product of this gene targets latent complexes of transforming growth factor beta to the extracellular matrix, where the latent cytokine is subsequently activated by several different mechanisms.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors