LYCAT Blocking Peptide (33R-10186)

A synthetic peptide for use as a blocking control in assays to test for specificity of LYCAT antibody, catalog no. 70R-6247

Synonyms LYCAT control peptide, LYCAT antibody Blocking Peptide, Anti-LYCAT Blocking Peptide, Lysocardiolipin Acyltransferase Blocking Peptide, ALCAT1 Blocking Peptide, FLJ37965 Blocking Peptide, UNQ1849 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues YLYSLVKWYFIITIVIFVLQERIFGGLEIIELACYRLLHKQPHLNSKKNE
Molecular Weight 44 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LYCAT is an acyl-CoA:lysocardiolipin acyltransferase. It possesses both lysophosphatidylinositol acyltransferase (LPIAT) and lysophosphatidylglycerol acyltransferase (LPGAT) activities. LYCAT recognises both monolysocardiolipin and dilysocardiolipin as substrates with a preference for linoleoyl-CoA and oleoyl-CoA as acyl donors. LYCAT acts as a remodeling enzyme for cardiolipin, a major membrane polyglycerophospholipid. It converts lysophosphatidic acid (LPA) into phosphatidic acid (PA) with a relatively low activity. LYCAT is required for establishment of the hematopoietic and endothelial lineages.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors