LYCAT Blocking Peptide (33R-10186)
A synthetic peptide for use as a blocking control in assays to test for specificity of LYCAT antibody, catalog no. 70R-6247
Overview
Overview
| Synonyms | LYCAT control peptide, LYCAT antibody Blocking Peptide, Anti-LYCAT Blocking Peptide, Lysocardiolipin Acyltransferase Blocking Peptide, ALCAT1 Blocking Peptide, FLJ37965 Blocking Peptide, UNQ1849 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | YLYSLVKWYFIITIVIFVLQERIFGGLEIIELACYRLLHKQPHLNSKKNE |
|---|---|
| Molecular Weight | 44 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | LYCAT is an acyl-CoA:lysocardiolipin acyltransferase. It possesses both lysophosphatidylinositol acyltransferase (LPIAT) and lysophosphatidylglycerol acyltransferase (LPGAT) activities. LYCAT recognises both monolysocardiolipin and dilysocardiolipin as substrates with a preference for linoleoyl-CoA and oleoyl-CoA as acyl donors. LYCAT acts as a remodeling enzyme for cardiolipin, a major membrane polyglycerophospholipid. It converts lysophosphatidic acid (LPA) into phosphatidic acid (PA) with a relatively low activity. LYCAT is required for establishment of the hematopoietic and endothelial lineages. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product