LYK5 antibody (70R-2049)

Rabbit polyclonal LYK5 antibody raised against the N terminal of LYK5

Synonyms Polyclonal LYK5 antibody, Anti-LYK5 antibody, FLJ90524 antibody, Protein Kinase Lyk5 antibody, LYK-5 antibody, LYK 5 antibody, LYK 5, LYK-5, STRAD antibody, PMSE antibody, LYK5
Specificity LYK5 antibody was raised against the N terminal of LYK5
Cross Reactivity Human
Applications WB
Immunogen LYK5 antibody was raised using the N terminal of LYK5 corresponding to a region with amino acids MSFLTNDASSESIASFSKQEVMSSFLPEGGCYELLTVIGKGFEDLMTVNL
Assay Information LYK5 Blocking Peptide, catalog no. 33R-6420, is also available for use as a blocking control in assays to test for specificity of this LYK5 antibody


Western Blot analysis using LYK5 antibody (70R-2049)

LYK5 antibody (70R-2049) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LYK5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LYK5 belongs to the protein kinase superfamily, STE Ser/Thr protein kinase family, STE20 subfamily. It contains 1 protein kinase domain. LYK5 is a pseudokinase which, in complex with CAB39, binds to and activates STK11.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using LYK5 antibody (70R-2049) | LYK5 antibody (70R-2049) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors