LYK5 Blocking Peptide (33R-1125)

A synthetic peptide for use as a blocking control in assays to test for specificity of LYK5 antibody, catalog no. 70R-2094

Synonyms LYK5 control peptide, LYK5 antibody Blocking Peptide, Anti-LYK5 Blocking Peptide, Protein Kinase Lyk5 Blocking Peptide, FLJ90524 Blocking Peptide, PMSE Blocking Peptide, STRAD Blocking Peptide, LYK5, LYK-5, LYK 5, LYK-5 Blocking Peptide, LYK 5 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues AEELTMSPSRSVANSGLSDSLTTSTPRPSNGDSPSHPYHRTFSPHFHHFV
Molecular Weight 44 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LYK5 belongs to the protein kinase superfamily, STE Ser/Thr protein kinase family, STE20 subfamily. It contains 1 protein kinase domain. LYK5 is a pseudokinase which, in complex with CAB39, binds to and activates STK11.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors