LYK5 Blocking Peptide (33R-1125)
A synthetic peptide for use as a blocking control in assays to test for specificity of LYK5 antibody, catalog no. 70R-2094
Overview
Overview
| Synonyms | LYK5 control peptide, LYK5 antibody Blocking Peptide, Anti-LYK5 Blocking Peptide, Protein Kinase Lyk5 Blocking Peptide, FLJ90524 Blocking Peptide, PMSE Blocking Peptide, STRAD Blocking Peptide, LYK5, LYK-5, LYK 5, LYK-5 Blocking Peptide, LYK 5 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | AEELTMSPSRSVANSGLSDSLTTSTPRPSNGDSPSHPYHRTFSPHFHHFV |
|---|---|
| Molecular Weight | 44 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | LYK5 belongs to the protein kinase superfamily, STE Ser/Thr protein kinase family, STE20 subfamily. It contains 1 protein kinase domain. LYK5 is a pseudokinase which, in complex with CAB39, binds to and activates STK11. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product