LYPD4 antibody (70R-5455)

Rabbit polyclonal LYPD4 antibody raised against the N terminal of LYPD4

Synonyms Polyclonal LYPD4 antibody, Anti-LYPD4 antibody, LYPD-4, Ly6/Plaur Domain Containing 4 antibody, LYPD-4 antibody, LYPD 4 antibody, SMR antibody, MGC42718 antibody, LYPD4, LYPD 4
Specificity LYPD4 antibody was raised against the N terminal of LYPD4
Cross Reactivity Human
Applications WB
Immunogen LYPD4 antibody was raised using the N terminal of LYPD4 corresponding to a region with amino acids MGPQHLRLVQLFCLLGAISTLPRAGALLCYEATASRFRAVAFHNWKWLLM
Assay Information LYPD4 Blocking Peptide, catalog no. 33R-6059, is also available for use as a blocking control in assays to test for specificity of this LYPD4 antibody


Western Blot analysis using LYPD4 antibody (70R-5455)

LYPD4 antibody (70R-5455) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 27 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LYPD4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of LYPD4 is not yet known.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using LYPD4 antibody (70R-5455) | LYPD4 antibody (70R-5455) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors