LYSMD1 antibody (70R-3813)

Rabbit polyclonal LYSMD1 antibody raised against the N terminal of LYSMD1

Synonyms Polyclonal LYSMD1 antibody, Anti-LYSMD1 antibody, LYSMD1, LYSMD-1 antibody, LYSMD 1 antibody, Lysm Putative Peptidoglycan-Binding Domain Containing 1 antibody, LYSMD 1, RP11-68I18.5 antibody, SB145 antibody, LYSMD-1, MGC35223 antibody
Specificity LYSMD1 antibody was raised against the N terminal of LYSMD1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen LYSMD1 antibody was raised using the N terminal of LYSMD1 corresponding to a region with amino acids VRERRLEHQLEPGDTLAGLALKYGVTMEQIKRANRLYTNDSIFLKKTLYI
Assay Information LYSMD1 Blocking Peptide, catalog no. 33R-9771, is also available for use as a blocking control in assays to test for specificity of this LYSMD1 antibody


Western Blot analysis using LYSMD1 antibody (70R-3813)

LYSMD1 antibody (70R-3813) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LYSMD1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of LYSMD1 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using LYSMD1 antibody (70R-3813) | LYSMD1 antibody (70R-3813) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors