M6PR antibody (70R-1887)

Rabbit polyclonal M6PR antibody

Synonyms Polyclonal M6PR antibody, Anti-M6PR antibody, MPR-6, FLJ32994 antibody, Mannose-6-Phosphate Receptor antibody, SMPR antibody, MPR 6 antibody, CD-MPR antibody, MPR-6 antibody, MPR46 antibody, M6PR, MPR 6
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen M6PR antibody was raised using a synthetic peptide corresponding to a region with amino acids RLKPLFNKSFESTVGQGSDTYIYIFRVCREAGNHTSGAGLVQINKSNGKE
Assay Information M6PR Blocking Peptide, catalog no. 33R-8035, is also available for use as a blocking control in assays to test for specificity of this M6PR antibody


Western Blot analysis using M6PR antibody (70R-1887)

M6PR antibody (70R-1887) used at 5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of M6PR antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance M6PR is a receptor for mannose-6-phosphate groups on lysosomal enzymes. The receptor forms a homodimer or homotetramer for intracellular targeting of lysosomal enzymes and export of newly synthesized lysosomal enzymes into the cell secretions. The receptor is an integral membrane protein which localizes to the trans-Golgi reticulum, endosomes, and the plasma membrane.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using M6PR antibody (70R-1887) | M6PR antibody (70R-1887) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors