MAGEA1 antibody (70R-1237)

Rabbit polyclonal MAGEA1 antibody

Synonyms Polyclonal MAGEA1 antibody, Anti-MAGEA1 antibody, MAGEA 1 antibody, MAGE1 antibody, MGC9326 antibody, Melanoma Antigen Family A 1 antibody, MAGEA1, MAGEA-1 antibody, MAGEA-1, MAGEA 1
Cross Reactivity Human
Applications WB
Immunogen MAGEA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MIAMEGGHAPEEEIWEELSVMEVYDGREHSAYGEPRKLLTQDLVQEKYLE
Assay Information MAGEA1 Blocking Peptide, catalog no. 33R-6107, is also available for use as a blocking control in assays to test for specificity of this MAGEA1 antibody


Western Blot analysis using MAGEA1 antibody (70R-1237)

MAGEA1 antibody (70R-1237) used at 5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of MAGEA1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MAGEA1 antibody (70R-1237) | MAGEA1 antibody (70R-1237) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors