MAGEA10 antibody (70R-3922)

Rabbit polyclonal MAGEA10 antibody raised against the middle region of MAGEA10

Synonyms Polyclonal MAGEA10 antibody, Anti-MAGEA10 antibody, Melanoma Antigen Family A 10 antibody, MAGE10 antibody, MGC10599 antibody, MAGEA10, MAGEA-10 antibody, MAGEA 10 antibody, MAGEA 10, MAGEA-10
Specificity MAGEA10 antibody was raised against the middle region of MAGEA10
Cross Reactivity Human
Applications WB
Immunogen MAGEA10 antibody was raised using the middle region of MAGEA10 corresponding to a region with amino acids GSDPRSFPLWYEEALKDEEERAQDRIATTDDTTAMASASSSATGSFSYPE
Assay Information MAGEA10 Blocking Peptide, catalog no. 33R-3555, is also available for use as a blocking control in assays to test for specificity of this MAGEA10 antibody

Images

Western Blot analysis using MAGEA10 antibody (70R-3922)

MAGEA10 antibody (70R-3922) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 41 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MAGEA10 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MAGEA10 antibody (70R-3922) | MAGEA10 antibody (70R-3922) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors