MAGEA4 antibody (70R-4207)

Rabbit polyclonal MAGEA4 antibody raised against the C terminal of MAGEA4

Synonyms Polyclonal MAGEA4 antibody, Anti-MAGEA4 antibody, MAGEA 4 antibody, MAGEA-4, MAGEA4, Melanoma Antigen Family A 4 antibody, MGC21336 antibody, MAGEA 4, MAGE-X2 antibody, MAGE4A antibody, MAGE4 antibody, MAGE-41 antibody, MAGE4B antibody, MAGEA-4 antibody
Specificity MAGEA4 antibody was raised against the C terminal of MAGEA4
Cross Reactivity Human
Applications WB
Immunogen MAGEA4 antibody was raised using the C terminal of MAGEA4 corresponding to a region with amino acids ENYLEYRQVPGSNPARYEFLWGPRALAETSYVKVLEHVVRVNARVRIAYP
Assay Information MAGEA4 Blocking Peptide, catalog no. 33R-2620, is also available for use as a blocking control in assays to test for specificity of this MAGEA4 antibody


Western Blot analysis using MAGEA4 antibody (70R-4207)

MAGEA4 antibody (70R-4207) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MAGEA4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MAGEA4 is a member of the MAGEA family. The members of this family are proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MAGEA4 antibody (70R-4207) | MAGEA4 antibody (70R-4207) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors