MAGEA5 Blocking Peptide (33R-6458)
A synthetic peptide for use as a blocking control in assays to test for specificity of MAGEA5 antibody, catalog no. 70R-4559
Overview
Overview
| Synonyms | MAGEA5 control peptide, MAGEA5 antibody Blocking Peptide, Anti-MAGEA5 Blocking Peptide, Melanoma Antigen Family A 5 Blocking Peptide, MAGE5 Blocking Peptide, MAGEA4 Blocking Peptide, MGC129526 Blocking Peptide, MAGEA5, MAGEA-5, MAGEA 5, MAGEA-5 Blocking Peptide, MAGEA 5 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | MSLEQKSQHCKPEEGLDTQEEALGLVGVQAATTEEQEAVSSSSPLVPGTL |
|---|---|
| Molecular Weight | 13 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. This MAGEA gene encodes a protein that is C-terminally truncated compared to other family members, and this gene can be alternatively interpreted to be a pseudogene. The protein is represented in this Entrez Gene record in accordance with the assumed protein-coding status defined in the literature. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product