MAGEB1 Blocking Peptide (33R-7528)
A synthetic peptide for use as a blocking control in assays to test for specificity of MAGEB1 antibody, catalog no. 70R-4381
Overview
Overview
| Synonyms | MAGEB1 control peptide, MAGEB1 antibody Blocking Peptide, Anti-MAGEB1 Blocking Peptide, Melanoma Antigen Family B 1 Blocking Peptide, DAM10 Blocking Peptide, MAGE-Xp Blocking Peptide, MAGEL1 Blocking Peptide, MGC9322 Blocking Peptide, MAGEB1, MAGEB-1, MAGEB 1, MAGEB-1 Blocking Peptide, MAGEB 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | QEKYLKYEQVPNSDPPRYQFLWGPRAYAETTKMKVLEFLAKMNGATPRDF |
|---|---|
| Molecular Weight | 39 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | This gene is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68% sequence identity to each other. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product