MAGEB1 Blocking Peptide (33R-7528)

A synthetic peptide for use as a blocking control in assays to test for specificity of MAGEB1 antibody, catalog no. 70R-4381

Synonyms MAGEB1 control peptide, MAGEB1 antibody Blocking Peptide, Anti-MAGEB1 Blocking Peptide, Melanoma Antigen Family B 1 Blocking Peptide, DAM10 Blocking Peptide, MAGE-Xp Blocking Peptide, MAGEL1 Blocking Peptide, MGC9322 Blocking Peptide, MAGEB1, MAGEB-1, MAGEB 1, MAGEB-1 Blocking Peptide, MAGEB 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues QEKYLKYEQVPNSDPPRYQFLWGPRAYAETTKMKVLEFLAKMNGATPRDF
Molecular Weight 39 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68% sequence identity to each other.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors