MAGEB3 antibody (70R-4427)

Rabbit polyclonal MAGEB3 antibody raised against the N terminal of MAGEB3

Synonyms Polyclonal MAGEB3 antibody, Anti-MAGEB3 antibody, MAGEB-3 antibody, MAGEB-3, MAGEB 3, MAGEB 3 antibody, MAGEB3, Melanoma Antigen Family B 3 antibody
Specificity MAGEB3 antibody was raised against the N terminal of MAGEB3
Cross Reactivity Human
Applications WB
Immunogen MAGEB3 antibody was raised using the N terminal of MAGEB3 corresponding to a region with amino acids KKKVSFSSPLILGATIQKKSAGRSRSALKKPQRALSTTTSVDVSYKKSYK
Assay Information MAGEB3 Blocking Peptide, catalog no. 33R-4479, is also available for use as a blocking control in assays to test for specificity of this MAGEB3 antibody


Western Blot analysis using MAGEB3 antibody (70R-4427)

MAGEB3 antibody (70R-4427) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MAGEB3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is a MAGE-B subfamily member of the MAGE gene family. MAGE family member proteins direct the expression of tumor antigens recognised on a human melanoma by autologous cytolytic T lymphocytes. There are two known clusters of MAGE genes on chromos

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MAGEB3 antibody (70R-4427) | MAGEB3 antibody (70R-4427) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors