MAGEC2 Blocking Peptide (33R-8333)

A synthetic peptide for use as a blocking control in assays to test for specificity of MAGEC2 antibody, catalog no. 70R-9923

Synonyms MAGEC2 control peptide, MAGEC2 antibody Blocking Peptide, Anti-MAGEC2 Blocking Peptide, melanoma antigen family C, 2 Blocking Peptide, CT10 Blocking Peptide, HCA587 Blocking Peptide, MAGEE1 Blocking Peptide, MGC13377 Blocking Peptide, MAGEC2, MAGEC-2, MAGEC 2, MAGEC-2 Blocking Peptide, MAGEC 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SCLMLEYWRHQLQQRRKEKERRVAREALRGEVGHLGLALEELQAQVQATS
Molecular Weight 20 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is a member of the MAGEC gene family. It is not expressed in normal tissues, except for testis, and is expressed in tumors of various histological types. This gene and the other MAGEC genes are clustered on chromosome Xq26-q27.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors