MAGEC2 Blocking Peptide (33R-8333)
A synthetic peptide for use as a blocking control in assays to test for specificity of MAGEC2 antibody, catalog no. 70R-9923
Overview
Overview
| Synonyms | MAGEC2 control peptide, MAGEC2 antibody Blocking Peptide, Anti-MAGEC2 Blocking Peptide, melanoma antigen family C, 2 Blocking Peptide, CT10 Blocking Peptide, HCA587 Blocking Peptide, MAGEE1 Blocking Peptide, MGC13377 Blocking Peptide, MAGEC2, MAGEC-2, MAGEC 2, MAGEC-2 Blocking Peptide, MAGEC 2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | SCLMLEYWRHQLQQRRKEKERRVAREALRGEVGHLGLALEELQAQVQATS |
|---|---|
| Molecular Weight | 20 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | This gene is a member of the MAGEC gene family. It is not expressed in normal tissues, except for testis, and is expressed in tumors of various histological types. This gene and the other MAGEC genes are clustered on chromosome Xq26-q27. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product