MAGED2 Blocking Peptide (33R-8995)
A synthetic peptide for use as a blocking control in assays to test for specificity of MAGED2 antibody, catalog no. 70R-9922
Overview
Overview
| Synonyms | MAGED2 control peptide, MAGED2 antibody Blocking Peptide, Anti-MAGED2 Blocking Peptide, melanoma antigen family D, 2 Blocking Peptide, 11B6 Blocking Peptide, BCG1 Blocking Peptide, HCA10 Blocking Peptide, JCL-1 Blocking Peptide, MAGE-D2 Blocking Peptide, MAGED Blocking Peptide, MGC8386 Blocking Peptide, MAGED2, MAGED-2, MAGED 2, MAGED-2 Blocking Peptide, MAGED 2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | TCGAHLTVVILYYGAALSMYLKPSSSNAQKIDKIISLLYGVLTPMLNPII |
|---|---|
| Molecular Weight | 35 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | This gene is a member of the MAGED gene family. While the MAGEA and MAGEB genes are silent in normal tissues with the exception of testis and placenta, the MAGED genes are expressed ubiquitously. The MAGED genes are clustered on chromosome Xp11. This gene is located in Xp11.2, a hot spot for X-linked mental retardation (XLMR). Multiple alternatively spliced transcript variants have been found for this gene, however, the full length nature of some variants has not been defined. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product