MAK antibody (70R-2672)

Rabbit polyclonal MAK antibody raised against the C terminal of MAK

Synonyms Polyclonal MAK antibody, Anti-MAK antibody, dJ417M14.2 antibody, Male Germ Cell-Associated Kinase antibody
Specificity MAK antibody was raised against the C terminal of MAK
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen MAK antibody was raised using the C terminal of MAK corresponding to a region with amino acids WNTKTGRGQFSGRTYNPTAKNLNIVNRAQPIPSVHGRTDWVAKYGGHR
Assay Information MAK Blocking Peptide, catalog no. 33R-9987, is also available for use as a blocking control in assays to test for specificity of this MAK antibody

Images

Western Blot analysis using MAK antibody (70R-2672)

MAK antibody (70R-2672) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 70 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MAK antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MAK is a serine/threonine protein kinase related to kinases involved in cell cycle regulation. It is expressed almost exclusively in the testis, primarily in germ cells. Studies of the mouse and rat homologs have localized the kinase to the chromosomes during meiosis in spermatogenesis, specifically to the synaptonemal complex that exists while homologous chromosomes are paired. There is, however, a study of the mouse homolog that has identified high levels of expression in developing sensory epithelia so its function may be more generalized.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MAK antibody (70R-2672) | MAK antibody (70R-2672) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors