MAOA antibody (70R-2465)

Rabbit polyclonal MAOA antibody raised against the middle region of MAOA

Synonyms Polyclonal MAOA antibody, Anti-MAOA antibody, Monoamine Oxidase A antibody
Specificity MAOA antibody was raised against the middle region of MAOA
Cross Reactivity Human,Rat,Dog
Applications WB
Immunogen MAOA antibody was raised using the middle region of MAOA corresponding to a region with amino acids NINVTSEPHEVSALWFLWYVKQCGGTTRIFSVTNGGQERKFVGGSGQVSE
Assay Information MAOA Blocking Peptide, catalog no. 33R-6729, is also available for use as a blocking control in assays to test for specificity of this MAOA antibody


Western Blot analysis using MAOA antibody (70R-2465)

MAOA antibody (70R-2465) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 60 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MAOA antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MAOA catalyzes the oxidative deamination of biogenic and xenobiotic amines and has important functions in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. MAOA preferentially oxidizes biogenic amines such as 5-hydroxytryptamine (5-HT), norepinephrine and epinephrine.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MAOA antibody (70R-2465) | MAOA antibody (70R-2465) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors