MAOA Blocking Peptide (33R-3485)

A synthetic peptide for use as a blocking control in assays to test for specificity of MAOA antibody, catalog no. 70R-2464

Synonyms MAOA control peptide, MAOA antibody Blocking Peptide, Anti-MAOA Blocking Peptide, Monoamine Oxidase A Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues GPTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRGAFPPVWNPIA
Molecular Weight 60 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MAOA catalyzes the oxidative deamination of biogenic and xenobiotic amines and has important functions in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. MAOA preferentially oxidizes biogenic amines such as 5-hydroxytryptamine (5-HT), norepinephrine and epinephrine.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors