MAOA Blocking Peptide (33R-3485)
A synthetic peptide for use as a blocking control in assays to test for specificity of MAOA antibody, catalog no. 70R-2464
Overview
Overview
| Synonyms | MAOA control peptide, MAOA antibody Blocking Peptide, Anti-MAOA Blocking Peptide, Monoamine Oxidase A Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | GPTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRGAFPPVWNPIA |
|---|---|
| Molecular Weight | 60 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | MAOA catalyzes the oxidative deamination of biogenic and xenobiotic amines and has important functions in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. MAOA preferentially oxidizes biogenic amines such as 5-hydroxytryptamine (5-HT), norepinephrine and epinephrine. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product