MAP3K15 antibody (70R-2087)

Rabbit polyclonal MAP3K15 antibody raised against the middle region of MAP3K15

Synonyms Polyclonal MAP3K15 antibody, Anti-MAP3K15 antibody, Mitogen-Activated Protein Kinase 15 antibody, FLJ16518 antibody, bA723P2.3 antibody, MAP3, MAP 3,MAP-3,MAP 3 antibody, MAP-3 antibody
Specificity MAP3K15 antibody was raised against the middle region of MAP3K15
Cross Reactivity Human
Applications WB
Immunogen MAP3K15 antibody was raised using the middle region of MAP3K15 corresponding to a region with amino acids TLEQKTQELYHLQLKLKSNCITENPAGPYGQRTDKELIDWLRLQGADAKT
Assay Information MAP3K15 Blocking Peptide, catalog no. 33R-9170, is also available for use as a blocking control in assays to test for specificity of this MAP3K15 antibody


Western Blot analysis using MAP3K15 antibody (70R-2087)

MAP3K15 antibody (70R-2087) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 89 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MAP3K15 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MAP3K15 is a component of a protein kinase signal transduction cascade.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MAP3K15 antibody (70R-2087) | MAP3K15 antibody (70R-2087) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors