MAP3K2 Blocking Peptide (33R-1147)

A synthetic peptide for use as a blocking control in assays to test for specificity of MAP3K2 antibody, catalog no. 70R-5767

Synonyms MAP3K2 control peptide, MAP3K2 antibody Blocking Peptide, Anti-MAP3K2 Blocking Peptide, Mitogen-Activated Protein Kinase 2 Blocking Peptide, MEKK2 Blocking Peptide, MEKK2B Blocking Peptide, MAP3, MAP-3, MAP 3, MAP-3 Blocking Peptide, MAP 3 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues AERKKRLSIIGPTSRDRSSPPPGYIPDELHQVARNGSFTSINSEGEFIPE
Molecular Weight 70 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MAP3K2 is a component of a protein kinase signal transduction cascade. It regulates the JNK and ERK5 pathways by phosphorylating and activating MAP2K5 and MAP2K7. It also plays a role in caveolae kiss-and-run dynamics.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors