MAP3K2 Blocking Peptide (33R-1147)
A synthetic peptide for use as a blocking control in assays to test for specificity of MAP3K2 antibody, catalog no. 70R-5767
Overview
Overview
| Synonyms | MAP3K2 control peptide, MAP3K2 antibody Blocking Peptide, Anti-MAP3K2 Blocking Peptide, Mitogen-Activated Protein Kinase 2 Blocking Peptide, MEKK2 Blocking Peptide, MEKK2B Blocking Peptide, MAP3, MAP-3, MAP 3, MAP-3 Blocking Peptide, MAP 3 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | AERKKRLSIIGPTSRDRSSPPPGYIPDELHQVARNGSFTSINSEGEFIPE |
|---|---|
| Molecular Weight | 70 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | MAP3K2 is a component of a protein kinase signal transduction cascade. It regulates the JNK and ERK5 pathways by phosphorylating and activating MAP2K5 and MAP2K7. It also plays a role in caveolae kiss-and-run dynamics. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product