MAP4K1 antibody (70R-3666)

Rabbit polyclonal MAP4K1 antibody raised against the N terminal of MAP4K1

Synonyms Polyclonal MAP4K1 antibody, Anti-MAP4K1 antibody, HPK1 antibody, MAP 4, MAP-4, Mitogen-Activated Protein Kinase 1 antibody, MAP-4 antibody, MAP 4 antibody, MAP4
Specificity MAP4K1 antibody was raised against the N terminal of MAP4K1
Cross Reactivity Human,Rat
Applications WB
Immunogen MAP4K1 antibody was raised using the N terminal of MAP4K1 corresponding to a region with amino acids VHPLRVLFLMTKSGYQPPRLKEKGKWSAAFHNFIKVTLTKSPKKRPSATK
Assay Information MAP4K1 Blocking Peptide, catalog no. 33R-9582, is also available for use as a blocking control in assays to test for specificity of this MAP4K1 antibody

Images

Western Blot analysis using MAP4K1 antibody (70R-3666)

MAP4K1 antibody (70R-3666) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 90 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MAP4K1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MAP4K1 belongs to the protein kinase superfamily, STE Ser/Thr protein kinase family, STE20 subfamily. MAP4K1 may play a role in the response to environmental stress. It appears to act upstream of the JUN N-terminal pathway. MAP4K1 may play a role in hematopoietic lineage decisions and growth regulation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MAP4K1 antibody (70R-3666) | MAP4K1 antibody (70R-3666) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors