MAPK1 Blocking Peptide (33R-7852)
A synthetic peptide for use as a blocking control in assays to test for specificity of MAPK1 antibody, catalog no. 70R-9624
Overview
Overview
| Synonyms | MAPK1 control peptide, MAPK1 antibody Blocking Peptide, Anti-MAPK1 Blocking Peptide, mitogen-activated protein kinase 1 Blocking Peptide, ERK Blocking Peptide, ERK2 Blocking Peptide, ERT1 Blocking Peptide, MAPK2 Blocking Peptide, P42MAPK Blocking Peptide, PRKM1 Blocking Peptide, PRKM2 Blocking Peptide, p38 Blocking Peptide, p40 Blocking Peptide, p41 Blocking Peptide, p41mapk Blocking Peptide, MAPK1, MAPK-1, MAPK 1, MAPK-1 Blocking Peptide, MAPK 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | RDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPE |
|---|---|
| Molecular Weight | 41 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The protein encoded by this gene is a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. The activation of this kinase requires its phosphorylation by upstream kinases. Upon activation, this kinase translocates to the nucleus of the stimulated cells, where it phosphorylates nuclear targets. Two alternatively spliced transcript variants encoding the same protein, but differing in the UTRs, have been reported for this gene. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product