MAPK14 Blocking Peptide (33R-10120)
A synthetic peptide for use as a blocking control in assays to test for specificity of MAPK14 antibody, catalog no. 20R-1305
Overview
Overview
| Synonyms | MAPK14 control peptide, MAPK14 antibody Blocking Peptide, Anti-MAPK14 Blocking Peptide, mitogen-activated protein kinase 14 Blocking Peptide, MAPK14, MAPK-14, MAPK 14, MAPK-14 Blocking Peptide, MAPK 14 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | YHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES |
|---|---|
| Molecular Weight | 41 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | MAPK14 is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is activated by various environmental stresses and proinflammatory cytokines. The activation requires its phosphorylation by MAP kinase kinases (MKKs), or its autophosphorylation triggered by the interaction of MAP3K7IP1/TAB1 protein with this kinase. The substrates of this kinase include transcription regulator ATF2, MEF2C, and MAX, cell cycle regulator CDC25B, and tumor suppressor p53, which suggest the roles of this kinase in stress related transcription and cell cycle regulation, as well as in genotoxic stress response. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product