MARK3 antibody (70R-4449)

Rabbit polyclonal MARK3 antibody raised against the middle region of MARK3

Synonyms Polyclonal MARK3 antibody, Anti-MARK3 antibody, Map/Microtubule Affinity-Regulating Kinase 3 antibody, MARK 3, CTAK1 antibody, MARK 3 antibody, MARK-3, MARK-3 antibody, KP78 antibody, PAR1A antibody, MARK3
Specificity MARK3 antibody was raised against the middle region of MARK3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen MARK3 antibody was raised using the middle region of MARK3 corresponding to a region with amino acids ATYNGPPASPSLSHEATPLSQTRSRGSTNLFSKLTSKLTRSRNVSAEQKD
Assay Information MARK3 Blocking Peptide, catalog no. 33R-1579, is also available for use as a blocking control in assays to test for specificity of this MARK3 antibody


Western Blot analysis using MARK3 antibody (70R-4449)

MARK3 antibody (70R-4449) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 81 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MARK3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MARK3 is involved in the specific phosphorylation of microtubule-associated proteins for tau, MAP2 and MAP4. Phosphorylates CDC25C on 'Ser-216'.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MARK3 antibody (70R-4449) | MARK3 antibody (70R-4449) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors