MARVELD3 antibody (70R-6394)

Rabbit polyclonal MARVELD3 antibody raised against the middle region of MARVELD3

Synonyms Polyclonal MARVELD3 antibody, Anti-MARVELD3 antibody, FLJ32280 antibody, MARVELD-3, MRVLDC3 antibody, MARVELD-3 antibody, MARVELD3, MARVELD 3 antibody, MARVD3 antibody, Marvel Domain Containing 3 antibody, MARVELD 3
Specificity MARVELD3 antibody was raised against the middle region of MARVELD3
Cross Reactivity Human,Mouse,Dog
Applications IHC, WB
Immunogen MARVELD3 antibody was raised using the middle region of MARVELD3 corresponding to a region with amino acids SYFVLAGFSASFSSGGGFGNNYYSPFEGTELEQVRQLDQQYTILRSPLIY
Assay Information MARVELD3 Blocking Peptide, catalog no. 33R-8948, is also available for use as a blocking control in assays to test for specificity of this MARVELD3 antibody

Images

Immunohistochemical staining using MARVELD3 antibody (70R-6394)

MARVELD3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MARVELD3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MARVELD3 is involved in membrane apposition and fusion events.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using MARVELD3 antibody (70R-6394) | MARVELD3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using MARVELD3 antibody (70R-6394) | MARVELD3 antibody (70R-6394) used at 0.25 ug/ml to detect target protein.
  • Immunohistochemical staining using MARVELD3 antibody (70R-6394) | MARVELD3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Hepatocytes (arrows) in Human Liver. Magnification is at 400X

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors