MAS1 Blocking Peptide (33R-8095)
A synthetic peptide for use as a blocking control in assays to test for specificity of MAS1 antibody, catalog no. 70R-1838
Overview
Overview
| Synonyms | MAS1 control peptide, MAS1 antibody Blocking Peptide, Anti-MAS1 Blocking Peptide, Mas1 Oncogene Blocking Peptide, MAS Blocking Peptide, MGC119966 Blocking Peptide, MAS1, MAS-1, MAS 1, MAS-1 Blocking Peptide, MAS 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | RPKYQSALVCALLWALSCLVTTMEYVMCIDREEESHSRNDCRAVIIFIAI |
|---|---|
| Molecular Weight | 37 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The structure of MAS1 indicates that it belongs to the class of receptors that are coupled to GTP-binding proteins and share a conserved structural motif, which is described as a '7-transmembrane segment' following the prediction that these hydrophobic segments form membrane-spanning alpha-helices. The MAS1 protein may be a receptor that, when activated, modulates a critical component in a growth-regulating pathway to bring about oncogenic effects. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product